• Home
  • Contact us
  • About us
  • Our Product
    • Weight loss & Metabolic
    • Healing & Recovery
    • Hormone & Growth
    • Anti-Aging & Longevity
    • Cognitive & Neuro
    • Skin & Aesthetic
    • Limitless
    • Accessories
  • COAs
Search
Login / Register
Wishlist
1 item / $144.99
Menu
1 item $144.99
“GHK-Cu 2mg (60 Capsules)” has been added to your cart. View cart
Click to enlarge
Home Limitless Cagrilintide Tre 5mg
Bromantane Powder 10g
Bromantane Powder 10g $39.89 – $140.19Price range: $39.89 through $140.19
Back to products
CardioCytogen 20mg
CardioCytogen 20mg $59.99

Cagrilintide Tre 5mg

$100.99 – $101.99Price range: $100.99 through $101.99

Clear
Compare
Add to wishlist
SKU: N/A Categories: Limitless, Weight loss & Metabolic Tags: cagri, Cagrilintide, Cagrilintide compound, Cagrilintide peptide, cagrilintide semaglutide, Cagrilintide Tre, Cagrilintide Tre 5mg, glp1, semaglutide, what is Cagrilintide, where to buy Cagrilintide online
Share:
  • Description
  • Research
  • COA
  • Additional information
  • Reviews (0)
  • Shipping & Delivery
Description

Product Description

Cagrilintide is a synthetic long-acting amylin analogue designed for in vitro research applications. This modified protein targets both amylin and calcitonin receptors through its specialized amino acid sequence and N-terminal lipidation.

The peptide demonstrates improved stability compared to native amylin while maintaining receptor binding affinity. Supplied as research-grade lyophilized powder with pharmaceutical manufacturing standards.

Third-party tested for purity verification. Intended for qualified research institutions conducting receptor studies and peptide mechanism research. Research use only.

Peptide Specifications

SPECIFICATION DESCRIPTION
Sequence XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Molecular Formula C194H312N54O59S2
Molecular Weight 4409.01 g/mol
CAS Number 1415456-99-3
PubChem SID 171397054
Synonyms AM833, AT42613
Purity ≥99% (HPLC)
Solubility Soluble in water and aqueous buffers
Storage Conditions Store at -20°C, tightly sealed, away from heat and moisture
Physical Appearance White lyophilized powder
Shelf Life 36 months from date of manufacture when stored properly
Quality Verification Third-party tested by certified laboratory
Manufacturing Standard USA-made, pharmaceutical-grade, GMP compliant
Intended Application In vitro research applications only

Our Product Quality Guarantee

Every Limitless Biotech compound undergoes independent testing for endotoxins and sterility, meeting rigorous research standards through our systematic quality protocols and proactive manufacturing processes.

Buy Cagrilintide From Limitless Biotech

Limitless Biotech provides USA-manufactured Cagrilintide for sale with verified molecular sequences and purity through comprehensive third-party testing. We ensure research quality with same-day shipping and dedicated customer support for your scientific endeavors.

Legal Disclaimer

This product is sold as a pure compound for research purposes only and is not meant for use as a dietary supplement. Please refer to our terms and conditions prior to purchase.

Safety Information: Keep this product out of the reach of children. This material has limited research available about it and may result in adverse effects if improperly handled or consumed. This product is not a dietary supplement, but a pure substance, sold as a raw material. We attest exclusively to the quality, purity and description of the materials we provide. This product is for use and handling only by persons with the knowledge and equipment to safely handle this material. You agree to indemnify us for any adverse effects that may arise from improper handling and/or consumption of this product.

The articles and information on products that may be found on this website are provided exclusively for the purposes of providing information and education. These items are not pharmaceuticals or medications, and the Food and Drug Administration has not given permission for the treatment or prevention of any disease, medical condition, or ailment using them.

Contains 500mcg – 1mg of trelahose per 5mg vial of cagrilintide to assist with solubility.

 

Research

Research

Cagrilintide Peptide Structure

Molecular formula: C194H312N54O59S2
Molecular weight:
4409.01 g/mol
PubChem SID:

433770923

CAS Number: 1415456-99-3
Research Applications:
  • Weight Loss and Obesity
  • Type 2 Diabetes
  • Glucose Regulation

Cagrilintide Research Overview

Cagrilintide is a novel, long-acting acylated amylin analogue that functions as a non-selective agonist for amylin receptors (AMYR) and the calcitonin G protein-coupled receptor (CTR). Cagrilintide is structurally similar to pramlintide but with key differences, including the lipidation of the N-terminal lysine and substitutions of three amino acids (N14E, V17R, and P37Y). These modifications are designed to improve stability and efficacy. Cagrilintide has shown promise in obesity research by significantly reducing food intake and inducing weight loss [R].

Cagrilintide works by activating amylin receptors, particularly in the homoeostatic and hedonic regions, leading to reduced appetite and increased feelings of fullness. Unlike natural amylin, which has a short half-life and a tendency to form amyloid fibrils, cagrilintide is engineered to have a longer action profile and greater stability [R].

Clinical trials have demonstrated that cagrilintide, both as monotherapy and in combination with the GLP-1 receptor agonist semaglutide (CagriSema), leads to significant weight loss in individuals with overweight and obesity. The combination therapy, CagriSema, has also shown improved glycemic control and greater weight loss compared to semaglutide alone in patients with type 2 diabetes [R, R, R].

COA

COA

Report 99% + grade

COA_Cagrilintide_5mg_US1196-72 vial 1_2024-10-08.COA_Cagrilintide_5mg_US1196-72 vial 1_2024-10-08.

Endotoxin Gel Clot Assay Report_Cagrilinitide Tre 1196-72_2-10-25_Limitless

Endotoxin Gel Clot Assay Report_Cagrilinitide Tre 99_5mg_119672_2-10-25_Limitless

Additional information
Option

5mg

lyophilized

lyophilized – 99%+ , lyophilized – 98.5%+

Reviews (0)

Reviews

There are no reviews yet.

Be the first to review “Cagrilintide Tre 5mg” Cancel reply

Your email address will not be published. Required fields are marked *

Shipping & Delivery

Related products

Compare

ARA-290 8mg

Limitless
$21.00 – $93.99Price range: $21.00 through $93.99
Product Description ARA-290 is a synthetic 11-amino acid peptide derived from the non-hematopoietic domain of erythropoietin, designed specifically for laboratory
Add to wishlist
Select options
Quick view
Compare

BPC-157 & TB-500 Blend

Healing & Recovery, Limitless
$199.99 – $319.99Price range: $199.99 through $319.99
Product Description This peptide blend combines BPC 157, a gastric pentadecapeptide, with Thymosin β4 Fragment 17-23 (TB-500) for advanced laboratory
Add to wishlist
Select options
Quick view
Compare

BPC-157 10mg

Healing & Recovery, Limitless
$91.99 – $96.99Price range: $91.99 through $96.99
BPC-157 Product Description BPC-157 is a synthetic peptide chain comprised of 15 amino acids, derived from a sequence of Body
Add to wishlist
Select options
Quick view
Compare

BPC-157 Spray

Healing & Recovery, Limitless
$94.99 – $97.99Price range: $94.99 through $97.99
BPC-157 Spray Product Description This precision-formulated BPC-157 spray delivers the complete 15-amino acid sequence in a stable liquid preparation. Manufactured
Add to wishlist
Select options
Quick view
Compare

Epitalon Peptide (30 Capsules)

Anti-Aging & Longevity, Limitless
$104.99
Epitalon Product Description Epitalon is a synthetic tetrapeptide composed of 4 amino acids with the sequence Ala-Glu-Asp-Gly, developed by the
Add to wishlist
Add to cart
Quick view
Compare

GHK-Cu 100mg (Copper Peptide)

Limitless, Skin & Aesthetic
$82.99 – $86.99Price range: $82.99 through $86.99
GHK-Cu Product Description GHK-Cu peptide is a naturally occurring copper tripeptide complex first isolated from human plasma in 1973. This
Add to wishlist
Select options
Quick view
Compare

GHK-Cu Spray

Limitless, Skin & Aesthetic
$86.99 – $144.99Price range: $86.99 through $144.99
Great sources for reading  https://www.hindawi.com/journals/bmri/2015/648108/ https://www.hindawi.com/journals/bmri/2014/151479/. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6073405/ http://www.skinbiology.com/Articles/AntiAgingActivityofGHK_JARCPFinal.pdf https://www.semanticscholar.org/paper/GHK-–-Copper-Peptide-in-Skin-Remodeling-and-!-in-Pickart/56992fa05930e1f6a22c3d84f80ff8ac6774f72b?p2df https://pubmed.ncbi.nlm.nih.gov/28370978/ https://www.walshmedicalmedia.com/open-access/effects-of-ghkcu-on-mmp-and-timp-expression-collagen-and-elastin-production-and-facial-wrinkle-parameters-2329-8847-1000166.pdf https://pubmed.ncbi.nlm.nih.gov/27517151/ https://www.mdpi.com/2079-9284/2/3/236/htm https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4556990/ https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4508379/ Lyophilized Peptides: These peptides are freeze-dried,
Add to wishlist
Select options
Quick view
Compare

Healing and Repair Research Blend (60 Capsules)

Limitless
$234.99
BPC-157 is a novel research chemical that exists in the form of a peptide chain consisting of 15 amino acids.
Add to wishlist
Add to cart
Quick view

    At Mile High Limitless, we are committed to advancing scientific research by providing top-quality, USA-made research peptides.

    • 5555 N. Lamar Blvd, Austin, TX
    • Phone: +1 313 (208) 10-15
    Products
    • Ipamorelin / CJC-1295 No Dac Ipamorelin / CJC-1295 No Dac $145.99 – $151.99Price range: $145.99 through $151.99
    • Sermorelin 10mg Sermorelin 10mg $66.99
    • Melanotan 1 HA Spray (10MG) Melanotan 1 HA Spray (10MG) $46.99 – $52.99Price range: $46.99 through $52.99
    Our stores
    • Home
    • Contact us
    • About us
    • Our Product
      • Weight loss & Metabolic
      • Healing & Recovery
      • Hormone & Growth
      • Anti-Aging & Longevity
      • Cognitive & Neuro
      • Skin & Aesthetic
      • Limitless
      • Accessories
    • COAs
    All rights reserved @ milehighlimitless.com
    • Menu
    • Categories
    • Accessories
    • Home
    • Contact us
    • About us
    • Our Product
      • Weight loss & Metabolic
      • Healing & Recovery
      • Hormone & Growth
      • Anti-Aging & Longevity
      • Cognitive & Neuro
      • Skin & Aesthetic
      • Limitless
      • Accessories
    • COAs
    • Wishlist
    • Compare
    • Login / Register
    Shopping cart
    Close
    Sign in
    Close

    Lost your password?

    No account yet?

    Create an Account
    Start typing to see products you are looking for.
    Shop
    Wishlist
    1 item Cart
    My account