Product Description

Cagrilintide is a synthetic long-acting amylin analogue designed for in vitro research applications. This modified protein targets both amylin and calcitonin receptors through its specialized amino acid sequence and N-terminal lipidation.

The peptide demonstrates improved stability compared to native amylin while maintaining receptor binding affinity. Supplied as research-grade lyophilized powder with pharmaceutical manufacturing standards.

Third-party tested for purity verification. Intended for qualified research institutions conducting receptor studies and peptide mechanism research. Research use only.

Peptide Specifications

SPECIFICATION	DESCRIPTION
Sequence	XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Molecular Formula	C₁₉₄H₃₁₂N₅₄O₅₉S₂
Molecular Weight	4409.01 g/mol
CAS Number	1415456-99-3
PubChem SID	171397054
Synonyms	AM833, AT42613
Purity	≥99% (HPLC)
Solubility	Soluble in water and aqueous buffers
Storage Conditions	Store at -20°C, tightly sealed, away from heat and moisture
Physical Appearance	White lyophilized powder
Shelf Life	36 months from date of manufacture when stored properly
Quality Verification	Third-party tested by certified laboratory
Manufacturing Standard	USA-made, pharmaceutical-grade, GMP compliant
Intended Application	In vitro research applications only

Our Product Quality Guarantee

Every Limitless Biotech compound undergoes independent testing for endotoxins and sterility, meeting rigorous research standards through our systematic quality protocols and proactive manufacturing processes.

Buy Cagrilintide From Limitless Biotech

Limitless Biotech provides USA-manufactured Cagrilintide for sale with verified molecular sequences and purity through comprehensive third-party testing. We ensure research quality with same-day shipping and dedicated customer support for your scientific endeavors.

Legal Disclaimer

This product is sold as a pure compound for research purposes only and is not meant for use as a dietary supplement. Please refer to our terms and conditions prior to purchase.

Safety Information: Keep this product out of the reach of children. This material has limited research available about it and may result in adverse effects if improperly handled or consumed. This product is not a dietary supplement, but a pure substance, sold as a raw material. We attest exclusively to the quality, purity and description of the materials we provide. This product is for use and handling only by persons with the knowledge and equipment to safely handle this material. You agree to indemnify us for any adverse effects that may arise from improper handling and/or consumption of this product.

The articles and information on products that may be found on this website are provided exclusively for the purposes of providing information and education. These items are not pharmaceuticals or medications, and the Food and Drug Administration has not given permission for the treatment or prevention of any disease, medical condition, or ailment using them.

Contains 500mcg – 1mg of trelahose per 5mg vial of cagrilintide to assist with solubility.

Research

Cagrilintide Peptide Structure

Molecular formula:	C₁₉₄H₃₁₂N₅₄O₅₉S₂
Molecular weight:	4409.01 g/mol
PubChem SID:	433770923
CAS Number:	1415456-99-3
Research Applications:	Weight Loss and Obesity Type 2 Diabetes Glucose Regulation

Cagrilintide Research Overview

Cagrilintide is a novel, long-acting acylated amylin analogue that functions as a non-selective agonist for amylin receptors (AMYR) and the calcitonin G protein-coupled receptor (CTR). Cagrilintide is structurally similar to pramlintide but with key differences, including the lipidation of the N-terminal lysine and substitutions of three amino acids (N14E, V17R, and P37Y). These modifications are designed to improve stability and efficacy. Cagrilintide has shown promise in obesity research by significantly reducing food intake and inducing weight loss [R].

Cagrilintide works by activating amylin receptors, particularly in the homoeostatic and hedonic regions, leading to reduced appetite and increased feelings of fullness. Unlike natural amylin, which has a short half-life and a tendency to form amyloid fibrils, cagrilintide is engineered to have a longer action profile and greater stability [R].

Clinical trials have demonstrated that cagrilintide, both as monotherapy and in combination with the GLP-1 receptor agonist semaglutide (CagriSema), leads to significant weight loss in individuals with overweight and obesity. The combination therapy, CagriSema, has also shown improved glycemic control and greater weight loss compared to semaglutide alone in patients with type 2 diabetes [R, R, R].

COA

Report 99% + grade

Additional information

Option	5mg
lyophilized	lyophilized – 99%+ , lyophilized – 98.5%+

Reviews (0)

Reviews

There are no reviews yet.

Be the first to review “Cagrilintide Tre 5mg”

Shipping & Delivery

Cagrilintide Tre 5mg